Anti ZNF699 pAb (ATL-HPA058287)

Atlas Antibodies

Catalog No: ATL-HPA058287-25

• 

Product Description

Protein Description: zinc finger protein 699
Gene Name: ZNF699
Alternative Gene Name: FLJ38144, hang
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026458: 27%, ENSRNOG00000003494: 29%
Entrez Gene ID: 374879
Uniprot ID: Q32M78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHE
• Gene Sequence: EQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHE
• Gene ID - Mouse: ENSMUSG00000026458
• Gene ID - Rat: ENSRNOG00000003494
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.