Protein Description: zinc finger protein 696
Gene Name: ZNF696
Alternative Gene Name: FLJ14129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 37%, ENSRNOG00000017837: 35%
Entrez Gene ID: 79943
Uniprot ID: Q9H7X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF696
Alternative Gene Name: FLJ14129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 37%, ENSRNOG00000017837: 35%
Entrez Gene ID: 79943
Uniprot ID: Q9H7X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QSGLESDVPPNAGPGAEGGGSWKGRPFPCGACGRSFKCSSDAAKHRSIHS |
| Documents & Links for Anti ZNF696 pAb (ATL-HPA072473) | |
| Datasheet | Anti ZNF696 pAb (ATL-HPA072473) Datasheet (External Link) |
| Vendor Page | Anti ZNF696 pAb (ATL-HPA072473) at Atlas |
| Documents & Links for Anti ZNF696 pAb (ATL-HPA072473) | |
| Datasheet | Anti ZNF696 pAb (ATL-HPA072473) Datasheet (External Link) |
| Vendor Page | Anti ZNF696 pAb (ATL-HPA072473) |