Anti ZNF692 pAb (ATL-HPA062792)

Atlas Antibodies

Catalog No: ATL-HPA062792-25

• 
• 

Product Description

Protein Description: zinc finger protein 692
Gene Name: ZNF692
Alternative Gene Name: AREBP, FLJ20531, Zfp692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037243: 90%, ENSRNOG00000002682: 89%
Entrez Gene ID: 55657
Uniprot ID: Q9BU19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCP
• Gene Sequence: ASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCP
• Gene ID - Mouse: ENSMUSG00000037243
• Gene ID - Rat: ENSRNOG00000002682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.