Description
Product Description
Protein Description: zinc finger protein 691
Gene Name: ZNF691
Alternative Gene Name: Zfp691
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045268: 52%, ENSRNOG00000007398: 58%
Entrez Gene ID: 51058
Uniprot ID: Q5VV52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF691
Alternative Gene Name: Zfp691
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045268: 52%, ENSRNOG00000007398: 58%
Entrez Gene ID: 51058
Uniprot ID: Q5VV52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPWQKVTVRARELGDPIAHPRHEADEKPFICAQ |
| Gene Sequence | KPWQKVTVRARELGDPIAHPRHEADEKPFICAQ |
| Gene ID - Mouse | ENSMUSG00000045268 |
| Gene ID - Rat | ENSRNOG00000007398 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ZNF691 pAb (ATL-HPA062527) | |
| Datasheet | Anti ZNF691 pAb (ATL-HPA062527) Datasheet (External Link) |
| Vendor Page | Anti ZNF691 pAb (ATL-HPA062527) at Atlas Antibodies |
| Documents & Links for Anti ZNF691 pAb (ATL-HPA062527) | |
| Datasheet | Anti ZNF691 pAb (ATL-HPA062527) Datasheet (External Link) |
| Vendor Page | Anti ZNF691 pAb (ATL-HPA062527) |