Anti ZNF671 pAb (ATL-HPA056043)

Atlas Antibodies

Catalog No: ATL-HPA056043-25

• 

Product Description

Protein Description: zinc finger protein 671
Gene Name: ZNF671
Alternative Gene Name: FLJ23506
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021636: 38%, ENSRNOG00000019730: 37%
Entrez Gene ID: 79891
Uniprot ID: Q8TAW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAELT
• Gene Sequence: PVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAELT
• Gene ID - Mouse: ENSMUSG00000021636
• Gene ID - Rat: ENSRNOG00000019730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.