Anti ZNF654 pAb (ATL-HPA077939)

Catalog No:
ATL-HPA077939-25
$447.00

Description

Product Description

Protein Description: zinc finger protein 654
Gene Name: ZNF654
Alternative Gene Name: FLJ10997, FLJ21142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047141: 99%, ENSRNOG00000029956: 99%
Entrez Gene ID: 55279
Uniprot ID: Q8IZM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA
Gene Sequence CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA
Gene ID - Mouse ENSMUSG00000047141
Gene ID - Rat ENSRNOG00000029956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF654 pAb (ATL-HPA077939)
Datasheet Anti ZNF654 pAb (ATL-HPA077939) Datasheet (External Link)
Vendor Page Anti ZNF654 pAb (ATL-HPA077939) at Atlas Antibodies

Documents & Links for Anti ZNF654 pAb (ATL-HPA077939)
Datasheet Anti ZNF654 pAb (ATL-HPA077939) Datasheet (External Link)
Vendor Page Anti ZNF654 pAb (ATL-HPA077939)

Product Description

Protein Description: zinc finger protein 654
Gene Name: ZNF654
Alternative Gene Name: FLJ10997, FLJ21142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047141: 99%, ENSRNOG00000029956: 99%
Entrez Gene ID: 55279
Uniprot ID: Q8IZM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA
Gene Sequence CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA
Gene ID - Mouse ENSMUSG00000047141
Gene ID - Rat ENSRNOG00000029956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF654 pAb (ATL-HPA077939)
Datasheet Anti ZNF654 pAb (ATL-HPA077939) Datasheet (External Link)
Vendor Page Anti ZNF654 pAb (ATL-HPA077939) at Atlas Antibodies

Documents & Links for Anti ZNF654 pAb (ATL-HPA077939)
Datasheet Anti ZNF654 pAb (ATL-HPA077939) Datasheet (External Link)
Vendor Page Anti ZNF654 pAb (ATL-HPA077939)