Protein Description: zinc finger protein 654
Gene Name: ZNF654
Alternative Gene Name: FLJ10997, FLJ21142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047141: 99%, ENSRNOG00000029956: 99%
Entrez Gene ID: 55279
Uniprot ID: Q8IZM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF654
Alternative Gene Name: FLJ10997, FLJ21142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047141: 99%, ENSRNOG00000029956: 99%
Entrez Gene ID: 55279
Uniprot ID: Q8IZM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA |
Documents & Links for Anti ZNF654 pAb (ATL-HPA077939) | |
Datasheet | Anti ZNF654 pAb (ATL-HPA077939) Datasheet (External Link) |
Vendor Page | Anti ZNF654 pAb (ATL-HPA077939) at Atlas |
Documents & Links for Anti ZNF654 pAb (ATL-HPA077939) | |
Datasheet | Anti ZNF654 pAb (ATL-HPA077939) Datasheet (External Link) |
Vendor Page | Anti ZNF654 pAb (ATL-HPA077939) |