Description
Product Description
Protein Description: zinc finger protein 646
Gene Name: ZNF646
Alternative Gene Name: KIAA0296
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049739: 67%, ENSRNOG00000026115: 68%
Entrez Gene ID: 9726
Uniprot ID: O15015
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF646
Alternative Gene Name: KIAA0296
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049739: 67%, ENSRNOG00000026115: 68%
Entrez Gene ID: 9726
Uniprot ID: O15015
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YQCSLCPRKYPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPDPVEAEAAPHTDQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAE |
Gene Sequence | YQCSLCPRKYPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPDPVEAEAAPHTDQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAE |
Gene ID - Mouse | ENSMUSG00000049739 |
Gene ID - Rat | ENSRNOG00000026115 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF646 pAb (ATL-HPA066468) | |
Datasheet | Anti ZNF646 pAb (ATL-HPA066468) Datasheet (External Link) |
Vendor Page | Anti ZNF646 pAb (ATL-HPA066468) at Atlas Antibodies |
Documents & Links for Anti ZNF646 pAb (ATL-HPA066468) | |
Datasheet | Anti ZNF646 pAb (ATL-HPA066468) Datasheet (External Link) |
Vendor Page | Anti ZNF646 pAb (ATL-HPA066468) |