Description
Product Description
Protein Description: zinc finger protein 644
Gene Name: ZNF644
Alternative Gene Name: BM-005, KIAA1221, MGC60165, MGC70410
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049606: 84%, ENSRNOG00000002112: 69%
Entrez Gene ID: 84146
Uniprot ID: Q9H582
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF644
Alternative Gene Name: BM-005, KIAA1221, MGC60165, MGC70410
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049606: 84%, ENSRNOG00000002112: 69%
Entrez Gene ID: 84146
Uniprot ID: Q9H582
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NGPVSHSSLTKTSNMNKGSVSLTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKS |
Gene Sequence | NGPVSHSSLTKTSNMNKGSVSLTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKS |
Gene ID - Mouse | ENSMUSG00000049606 |
Gene ID - Rat | ENSRNOG00000002112 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF644 pAb (ATL-HPA057795) | |
Datasheet | Anti ZNF644 pAb (ATL-HPA057795) Datasheet (External Link) |
Vendor Page | Anti ZNF644 pAb (ATL-HPA057795) at Atlas Antibodies |
Documents & Links for Anti ZNF644 pAb (ATL-HPA057795) | |
Datasheet | Anti ZNF644 pAb (ATL-HPA057795) Datasheet (External Link) |
Vendor Page | Anti ZNF644 pAb (ATL-HPA057795) |