Anti ZNF630 pAb (ATL-HPA068130)

Catalog No:
ATL-HPA068130-25
$447.00

Description

Product Description

Protein Description: zinc finger protein 630
Gene Name: ZNF630
Alternative Gene Name: BC037316, dJ54B20.2, FLJ20573, MGC138344
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 29%, ENSRNOG00000057227: 28%
Entrez Gene ID: 57232
Uniprot ID: Q2M218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQQIISGELLFQREILERAPKDNSLYSVLKIWHIDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDSCE
Gene Sequence SQQIISGELLFQREILERAPKDNSLYSVLKIWHIDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDSCE
Gene ID - Mouse ENSMUSG00000055835
Gene ID - Rat ENSRNOG00000057227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF630 pAb (ATL-HPA068130)
Datasheet Anti ZNF630 pAb (ATL-HPA068130) Datasheet (External Link)
Vendor Page Anti ZNF630 pAb (ATL-HPA068130) at Atlas Antibodies

Documents & Links for Anti ZNF630 pAb (ATL-HPA068130)
Datasheet Anti ZNF630 pAb (ATL-HPA068130) Datasheet (External Link)
Vendor Page Anti ZNF630 pAb (ATL-HPA068130)

Product Description

Protein Description: zinc finger protein 630
Gene Name: ZNF630
Alternative Gene Name: BC037316, dJ54B20.2, FLJ20573, MGC138344
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 29%, ENSRNOG00000057227: 28%
Entrez Gene ID: 57232
Uniprot ID: Q2M218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQQIISGELLFQREILERAPKDNSLYSVLKIWHIDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDSCE
Gene Sequence SQQIISGELLFQREILERAPKDNSLYSVLKIWHIDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDSCE
Gene ID - Mouse ENSMUSG00000055835
Gene ID - Rat ENSRNOG00000057227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF630 pAb (ATL-HPA068130)
Datasheet Anti ZNF630 pAb (ATL-HPA068130) Datasheet (External Link)
Vendor Page Anti ZNF630 pAb (ATL-HPA068130) at Atlas Antibodies

Documents & Links for Anti ZNF630 pAb (ATL-HPA068130)
Datasheet Anti ZNF630 pAb (ATL-HPA068130) Datasheet (External Link)
Vendor Page Anti ZNF630 pAb (ATL-HPA068130)