Protein Description: zinc finger protein 630
Gene Name: ZNF630
Alternative Gene Name: BC037316, dJ54B20.2, FLJ20573, MGC138344
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 29%, ENSRNOG00000057227: 28%
Entrez Gene ID: 57232
Uniprot ID: Q2M218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF630
Alternative Gene Name: BC037316, dJ54B20.2, FLJ20573, MGC138344
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 29%, ENSRNOG00000057227: 28%
Entrez Gene ID: 57232
Uniprot ID: Q2M218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SQQIISGELLFQREILERAPKDNSLYSVLKIWHIDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDSCE |
Documents & Links for Anti ZNF630 pAb (ATL-HPA068130) | |
Datasheet | Anti ZNF630 pAb (ATL-HPA068130) Datasheet (External Link) |
Vendor Page | Anti ZNF630 pAb (ATL-HPA068130) at Atlas |
Documents & Links for Anti ZNF630 pAb (ATL-HPA068130) | |
Datasheet | Anti ZNF630 pAb (ATL-HPA068130) Datasheet (External Link) |
Vendor Page | Anti ZNF630 pAb (ATL-HPA068130) |