Protein Description: zinc finger protein 624
Gene Name: ZNF624
Alternative Gene Name: KIAA1349
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047342: 36%, ENSRNOG00000003218: 39%
Entrez Gene ID: 57547
Uniprot ID: Q9P2J8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF624
Alternative Gene Name: KIAA1349
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047342: 36%, ENSRNOG00000003218: 39%
Entrez Gene ID: 57547
Uniprot ID: Q9P2J8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLVKESVTFKDVAIDFTLEEWRLMD |
Documents & Links for Anti ZNF624 pAb (ATL-HPA023157) | |
Datasheet | Anti ZNF624 pAb (ATL-HPA023157) Datasheet (External Link) |
Vendor Page | Anti ZNF624 pAb (ATL-HPA023157) at Atlas |
Documents & Links for Anti ZNF624 pAb (ATL-HPA023157) | |
Datasheet | Anti ZNF624 pAb (ATL-HPA023157) Datasheet (External Link) |
Vendor Page | Anti ZNF624 pAb (ATL-HPA023157) |