Description
Product Description
Protein Description: zinc finger protein 621
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037989: 27%, ENSRNOG00000019318: 27%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037989: 27%, ENSRNOG00000019318: 27%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLT |
Gene Sequence | WYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLT |
Gene ID - Mouse | ENSMUSG00000037989 |
Gene ID - Rat | ENSRNOG00000019318 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF621 pAb (ATL-HPA071440) | |
Datasheet | Anti ZNF621 pAb (ATL-HPA071440) Datasheet (External Link) |
Vendor Page | Anti ZNF621 pAb (ATL-HPA071440) at Atlas Antibodies |
Documents & Links for Anti ZNF621 pAb (ATL-HPA071440) | |
Datasheet | Anti ZNF621 pAb (ATL-HPA071440) Datasheet (External Link) |
Vendor Page | Anti ZNF621 pAb (ATL-HPA071440) |