Anti ZNF621 pAb (ATL-HPA071440)

Atlas Antibodies

Catalog No: ATL-HPA071440-100

• 
• 

Product Description

Protein Description: zinc finger protein 621
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037989: 27%, ENSRNOG00000019318: 27%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLT
• Gene Sequence: WYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLT
• Gene ID - Mouse: ENSMUSG00000037989
• Gene ID - Rat: ENSRNOG00000019318
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.