Protein Description: zinc finger protein 621
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 26%, ENSRNOG00000010233: 26%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 26%, ENSRNOG00000010233: 26%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNL |
| Documents & Links for Anti ZNF621 pAb (ATL-HPA065518) | |
| Datasheet | Anti ZNF621 pAb (ATL-HPA065518) Datasheet (External Link) |
| Vendor Page | Anti ZNF621 pAb (ATL-HPA065518) at Atlas |
| Documents & Links for Anti ZNF621 pAb (ATL-HPA065518) | |
| Datasheet | Anti ZNF621 pAb (ATL-HPA065518) Datasheet (External Link) |
| Vendor Page | Anti ZNF621 pAb (ATL-HPA065518) |