Description
Product Description
Protein Description: zinc finger protein 616
Gene Name: ZNF616
Alternative Gene Name: MGC45556
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096856: 37%, ENSRNOG00000053687: 36%
Entrez Gene ID: 90317
Uniprot ID: Q08AN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF616
Alternative Gene Name: MGC45556
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096856: 37%, ENSRNOG00000053687: 36%
Entrez Gene ID: 90317
Uniprot ID: Q08AN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN |
Gene Sequence | NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN |
Gene ID - Mouse | ENSMUSG00000096856 |
Gene ID - Rat | ENSRNOG00000053687 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF616 pAb (ATL-HPA062639) | |
Datasheet | Anti ZNF616 pAb (ATL-HPA062639) Datasheet (External Link) |
Vendor Page | Anti ZNF616 pAb (ATL-HPA062639) at Atlas Antibodies |
Documents & Links for Anti ZNF616 pAb (ATL-HPA062639) | |
Datasheet | Anti ZNF616 pAb (ATL-HPA062639) Datasheet (External Link) |
Vendor Page | Anti ZNF616 pAb (ATL-HPA062639) |