Protein Description: zinc finger protein 608
Gene Name: ZNF608
Alternative Gene Name: DKFZp434M098, KIAA1281, NY-REN-36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052713: 87%, ENSRNOG00000023197: 83%
Entrez Gene ID: 57507
Uniprot ID: Q9ULD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF608
Alternative Gene Name: DKFZp434M098, KIAA1281, NY-REN-36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052713: 87%, ENSRNOG00000023197: 83%
Entrez Gene ID: 57507
Uniprot ID: Q9ULD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DIISSKDSVVKGHSSTTAQSSQLKESHSPYYHSYDPYYSPSYMHPGQVGAPAAGNSGSTQGMKIKKESEEDAEKKD |
| Documents & Links for Anti ZNF608 pAb (ATL-HPA076984) | |
| Datasheet | Anti ZNF608 pAb (ATL-HPA076984) Datasheet (External Link) |
| Vendor Page | Anti ZNF608 pAb (ATL-HPA076984) at Atlas |
| Documents & Links for Anti ZNF608 pAb (ATL-HPA076984) | |
| Datasheet | Anti ZNF608 pAb (ATL-HPA076984) Datasheet (External Link) |
| Vendor Page | Anti ZNF608 pAb (ATL-HPA076984) |