Anti ZNF605 pAb (ATL-HPA062655)

Atlas Antibodies

Catalog No: ATL-HPA062655-25

• 

Product Description

Protein Description: zinc finger protein 605
Gene Name: ZNF605
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023284: 44%, ENSRNOG00000037428: 44%
Entrez Gene ID: 100289635
Uniprot ID: Q86T29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF
• Gene Sequence: CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF
• Gene ID - Mouse: ENSMUSG00000023284
• Gene ID - Rat: ENSRNOG00000037428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.