Anti ZNF594 pAb (ATL-HPA077596)

Catalog No:
ATL-HPA077596-25
$447.00

Description

Product Description

Protein Description: zinc finger protein 594
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV
Gene Sequence QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF594 pAb (ATL-HPA077596)
Datasheet Anti ZNF594 pAb (ATL-HPA077596) Datasheet (External Link)
Vendor Page Anti ZNF594 pAb (ATL-HPA077596) at Atlas Antibodies

Documents & Links for Anti ZNF594 pAb (ATL-HPA077596)
Datasheet Anti ZNF594 pAb (ATL-HPA077596) Datasheet (External Link)
Vendor Page Anti ZNF594 pAb (ATL-HPA077596)

Product Description

Protein Description: zinc finger protein 594
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV
Gene Sequence QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF594 pAb (ATL-HPA077596)
Datasheet Anti ZNF594 pAb (ATL-HPA077596) Datasheet (External Link)
Vendor Page Anti ZNF594 pAb (ATL-HPA077596) at Atlas Antibodies

Documents & Links for Anti ZNF594 pAb (ATL-HPA077596)
Datasheet Anti ZNF594 pAb (ATL-HPA077596) Datasheet (External Link)
Vendor Page Anti ZNF594 pAb (ATL-HPA077596)