Anti ZNF594 pAb (ATL-HPA069360)

Atlas Antibodies

Catalog No: ATL-HPA069360-25

• 

Product Description

Protein Description: zinc finger protein 594
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005267: 48%, ENSRNOG00000049975: 50%
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHAGEKLEECEKTFSKDEELRKEQRTHQEKKVYWCNQCSRTFQGSSDLIRH
• Gene Sequence: LHAGEKLEECEKTFSKDEELRKEQRTHQEKKVYWCNQCSRTFQGSSDLIRH
• Gene ID - Mouse: ENSMUSG00000005267
• Gene ID - Rat: ENSRNOG00000049975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.