Description
Product Description
Protein Description: zinc finger protein 594
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037007: 52%, ENSRNOG00000049975: 52%
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037007: 52%, ENSRNOG00000049975: 52%
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV |
Gene Sequence | QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV |
Gene ID - Mouse | ENSMUSG00000037007 |
Gene ID - Rat | ENSRNOG00000049975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF594 pAb (ATL-HPA067178) | |
Datasheet | Anti ZNF594 pAb (ATL-HPA067178) Datasheet (External Link) |
Vendor Page | Anti ZNF594 pAb (ATL-HPA067178) at Atlas Antibodies |
Documents & Links for Anti ZNF594 pAb (ATL-HPA067178) | |
Datasheet | Anti ZNF594 pAb (ATL-HPA067178) Datasheet (External Link) |
Vendor Page | Anti ZNF594 pAb (ATL-HPA067178) |