Anti ZNF579 pAb (ATL-HPA062812)

Atlas Antibodies

Catalog No: ATL-HPA062812-25

• 
• 

Product Description

Protein Description: zinc finger protein 579
Gene Name: ZNF579
Alternative Gene Name: FLJ35453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051550: 100%, ENSRNOG00000016608: 100%
Entrez Gene ID: 163033
Uniprot ID: Q8NAF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAELRAELALAAGRQEEKQVLLQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQC
• Gene Sequence: AAELRAELALAAGRQEEKQVLLQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQC
• Gene ID - Mouse: ENSMUSG00000051550
• Gene ID - Rat: ENSRNOG00000016608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.