Protein Description: zinc finger protein 574
Gene Name: ZNF574
Alternative Gene Name: FLJ22059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045252: 89%, ENSRNOG00000055761: 90%
Entrez Gene ID: 64763
Uniprot ID: Q6ZN55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF574
Alternative Gene Name: FLJ22059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045252: 89%, ENSRNOG00000055761: 90%
Entrez Gene ID: 64763
Uniprot ID: Q6ZN55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SPKAPPLSSSTIHYECVDCKALFASQELWLNHRQTHLRATPTKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVELLL |
Documents & Links for Anti ZNF574 pAb (ATL-HPA023196) | |
Datasheet | Anti ZNF574 pAb (ATL-HPA023196) Datasheet (External Link) |
Vendor Page | Anti ZNF574 pAb (ATL-HPA023196) at Atlas |
Documents & Links for Anti ZNF574 pAb (ATL-HPA023196) | |
Datasheet | Anti ZNF574 pAb (ATL-HPA023196) Datasheet (External Link) |
Vendor Page | Anti ZNF574 pAb (ATL-HPA023196) |