Protein Description: zinc finger protein 572
Gene Name: ZNF572
Alternative Gene Name: FLJ38002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021388: 27%, ENSRNOG00000013451: 29%
Entrez Gene ID: 137209
Uniprot ID: Q7Z3I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF572
Alternative Gene Name: FLJ38002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021388: 27%, ENSRNOG00000013451: 29%
Entrez Gene ID: 137209
Uniprot ID: Q7Z3I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DSNSFMERESLKSPFTGDTSMNNLETVHHNNSKADKLKEKPSEWSKRHRPQHYKHEDAKEMPL |
Documents & Links for Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) | |
Datasheet | Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) at Atlas |
Documents & Links for Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) | |
Datasheet | Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) |