Protein Description: zinc finger protein 560
Gene Name: ZNF560
Alternative Gene Name: FLJ31986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058192: 42%, ENSRNOG00000033624: 42%
Entrez Gene ID: 147741
Uniprot ID: Q96MR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF560
Alternative Gene Name: FLJ31986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058192: 42%, ENSRNOG00000033624: 42%
Entrez Gene ID: 147741
Uniprot ID: Q96MR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS |
| Documents & Links for Anti ZNF560 pAb (ATL-HPA074438) | |
| Datasheet | Anti ZNF560 pAb (ATL-HPA074438) Datasheet (External Link) |
| Vendor Page | Anti ZNF560 pAb (ATL-HPA074438) at Atlas |
| Documents & Links for Anti ZNF560 pAb (ATL-HPA074438) | |
| Datasheet | Anti ZNF560 pAb (ATL-HPA074438) Datasheet (External Link) |
| Vendor Page | Anti ZNF560 pAb (ATL-HPA074438) |