Anti ZNF560 pAb (ATL-HPA063209)

Catalog No:
ATL-HPA063209-25
$447.00

Description

Product Description

Protein Description: zinc finger protein 560
Gene Name: ZNF560
Alternative Gene Name: FLJ31986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058192: 42%, ENSRNOG00000033624: 42%
Entrez Gene ID: 147741
Uniprot ID: Q96MR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS
Gene Sequence ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS
Gene ID - Mouse ENSMUSG00000058192
Gene ID - Rat ENSRNOG00000033624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF560 pAb (ATL-HPA063209)
Datasheet Anti ZNF560 pAb (ATL-HPA063209) Datasheet (External Link)
Vendor Page Anti ZNF560 pAb (ATL-HPA063209) at Atlas Antibodies

Documents & Links for Anti ZNF560 pAb (ATL-HPA063209)
Datasheet Anti ZNF560 pAb (ATL-HPA063209) Datasheet (External Link)
Vendor Page Anti ZNF560 pAb (ATL-HPA063209)

Product Description

Protein Description: zinc finger protein 560
Gene Name: ZNF560
Alternative Gene Name: FLJ31986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058192: 42%, ENSRNOG00000033624: 42%
Entrez Gene ID: 147741
Uniprot ID: Q96MR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS
Gene Sequence ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS
Gene ID - Mouse ENSMUSG00000058192
Gene ID - Rat ENSRNOG00000033624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF560 pAb (ATL-HPA063209)
Datasheet Anti ZNF560 pAb (ATL-HPA063209) Datasheet (External Link)
Vendor Page Anti ZNF560 pAb (ATL-HPA063209) at Atlas Antibodies

Documents & Links for Anti ZNF560 pAb (ATL-HPA063209)
Datasheet Anti ZNF560 pAb (ATL-HPA063209) Datasheet (External Link)
Vendor Page Anti ZNF560 pAb (ATL-HPA063209)