Protein Description: zinc finger protein 559
Gene Name: ZNF559
Alternative Gene Name: MGC13105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054737: 42%, ENSRNOG00000026572: 38%
Entrez Gene ID: 84527
Uniprot ID: Q9BR84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF559
Alternative Gene Name: MGC13105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054737: 42%, ENSRNOG00000026572: 38%
Entrez Gene ID: 84527
Uniprot ID: Q9BR84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EKAFRKPSIFTLHKKTDIGEELPNCNQCETAFSQHLHLVCKKTSQNLHLVCKKTH |
| Documents & Links for Anti ZNF559 pAb (ATL-HPA065485) | |
| Datasheet | Anti ZNF559 pAb (ATL-HPA065485) Datasheet (External Link) |
| Vendor Page | Anti ZNF559 pAb (ATL-HPA065485) at Atlas |
| Documents & Links for Anti ZNF559 pAb (ATL-HPA065485) | |
| Datasheet | Anti ZNF559 pAb (ATL-HPA065485) Datasheet (External Link) |
| Vendor Page | Anti ZNF559 pAb (ATL-HPA065485) |