Anti ZNF559 pAb (ATL-HPA065485)

Atlas Antibodies

Catalog No: ATL-HPA065485-25

• 

Product Description

Protein Description: zinc finger protein 559
Gene Name: ZNF559
Alternative Gene Name: MGC13105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054737: 42%, ENSRNOG00000026572: 38%
Entrez Gene ID: 84527
Uniprot ID: Q9BR84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKAFRKPSIFTLHKKTDIGEELPNCNQCETAFSQHLHLVCKKTSQNLHLVCKKTH
• Gene Sequence: EKAFRKPSIFTLHKKTDIGEELPNCNQCETAFSQHLHLVCKKTSQNLHLVCKKTH
• Gene ID - Mouse: ENSMUSG00000054737
• Gene ID - Rat: ENSRNOG00000026572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.