Anti ZNF554 pAb (ATL-HPA063358)

Atlas Antibodies

Catalog No: ATL-HPA063358-25

• 

Product Description

Protein Description: zinc finger protein 554
Gene Name: ZNF554
Alternative Gene Name: FLJ34817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059975: 34%, ENSRNOG00000048894: 34%
Entrez Gene ID: 115196
Uniprot ID: Q86TJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKP
• Gene Sequence: GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKP
• Gene ID - Mouse: ENSMUSG00000059975
• Gene ID - Rat: ENSRNOG00000048894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.