Description
Product Description
Protein Description: zinc finger protein 554
Gene Name: ZNF554
Alternative Gene Name: FLJ34817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059975: 34%, ENSRNOG00000048894: 34%
Entrez Gene ID: 115196
Uniprot ID: Q86TJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF554
Alternative Gene Name: FLJ34817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059975: 34%, ENSRNOG00000048894: 34%
Entrez Gene ID: 115196
Uniprot ID: Q86TJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKP |
Gene Sequence | GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKP |
Gene ID - Mouse | ENSMUSG00000059975 |
Gene ID - Rat | ENSRNOG00000048894 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF554 pAb (ATL-HPA063358) | |
Datasheet | Anti ZNF554 pAb (ATL-HPA063358) Datasheet (External Link) |
Vendor Page | Anti ZNF554 pAb (ATL-HPA063358) at Atlas Antibodies |
Documents & Links for Anti ZNF554 pAb (ATL-HPA063358) | |
Datasheet | Anti ZNF554 pAb (ATL-HPA063358) Datasheet (External Link) |
Vendor Page | Anti ZNF554 pAb (ATL-HPA063358) |