![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99744/179405/atl-hpa066042_anti-znf548-pab-atl-hpa066042_61067__76075.1681135092.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: zinc finger protein 548
Gene Name: ZNF548
Alternative Gene Name: FLJ32932
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097333: 39%, ENSRNOG00000016462: 39%
Entrez Gene ID: 147694
Uniprot ID: Q8NEK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF548
Alternative Gene Name: FLJ32932
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097333: 39%, ENSRNOG00000016462: 39%
Entrez Gene ID: 147694
Uniprot ID: Q8NEK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQ |
| Documents & Links for Anti ZNF548 pAb (ATL-HPA066042) | |
| Datasheet | Anti ZNF548 pAb (ATL-HPA066042) Datasheet (External Link) |
| Vendor Page | Anti ZNF548 pAb (ATL-HPA066042) at Atlas |
| Documents & Links for Anti ZNF548 pAb (ATL-HPA066042) | |
| Datasheet | Anti ZNF548 pAb (ATL-HPA066042) Datasheet (External Link) |
| Vendor Page | Anti ZNF548 pAb (ATL-HPA066042) |