Anti ZNF548 pAb (ATL-HPA066042)

Catalog No:
ATL-HPA066042-25
$447.00

Description

Product Description

Protein Description: zinc finger protein 548
Gene Name: ZNF548
Alternative Gene Name: FLJ32932
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097333: 39%, ENSRNOG00000016462: 39%
Entrez Gene ID: 147694
Uniprot ID: Q8NEK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQ
Gene Sequence HRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQ
Gene ID - Mouse ENSMUSG00000097333
Gene ID - Rat ENSRNOG00000016462
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF548 pAb (ATL-HPA066042)
Datasheet Anti ZNF548 pAb (ATL-HPA066042) Datasheet (External Link)
Vendor Page Anti ZNF548 pAb (ATL-HPA066042) at Atlas Antibodies

Documents & Links for Anti ZNF548 pAb (ATL-HPA066042)
Datasheet Anti ZNF548 pAb (ATL-HPA066042) Datasheet (External Link)
Vendor Page Anti ZNF548 pAb (ATL-HPA066042)

Product Description

Protein Description: zinc finger protein 548
Gene Name: ZNF548
Alternative Gene Name: FLJ32932
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097333: 39%, ENSRNOG00000016462: 39%
Entrez Gene ID: 147694
Uniprot ID: Q8NEK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQ
Gene Sequence HRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQ
Gene ID - Mouse ENSMUSG00000097333
Gene ID - Rat ENSRNOG00000016462
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF548 pAb (ATL-HPA066042)
Datasheet Anti ZNF548 pAb (ATL-HPA066042) Datasheet (External Link)
Vendor Page Anti ZNF548 pAb (ATL-HPA066042) at Atlas Antibodies

Documents & Links for Anti ZNF548 pAb (ATL-HPA066042)
Datasheet Anti ZNF548 pAb (ATL-HPA066042) Datasheet (External Link)
Vendor Page Anti ZNF548 pAb (ATL-HPA066042)