Protein Description: zinc finger protein 541
Gene Name: ZNF541
Alternative Gene Name: DKFZp434I1930
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078796: 75%, ENSRNOG00000021800: 75%
Entrez Gene ID: 84215
Uniprot ID: Q9H0D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF541
Alternative Gene Name: DKFZp434I1930
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078796: 75%, ENSRNOG00000021800: 75%
Entrez Gene ID: 84215
Uniprot ID: Q9H0D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PKKVKVDCDSFLCQNPGEPGLQEAQKAGGLPADASPLFRQLFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQV |
| Documents & Links for Anti ZNF541 pAb (ATL-HPA076453 w/enhanced validation) | |
| Datasheet | Anti ZNF541 pAb (ATL-HPA076453 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZNF541 pAb (ATL-HPA076453 w/enhanced validation) at Atlas |
| Documents & Links for Anti ZNF541 pAb (ATL-HPA076453 w/enhanced validation) | |
| Datasheet | Anti ZNF541 pAb (ATL-HPA076453 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZNF541 pAb (ATL-HPA076453 w/enhanced validation) |