Protein Description: zinc finger protein 536
Gene Name: ZNF536
Alternative Gene Name: KIAA0390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043456: 77%, ENSRNOG00000014163: 80%
Entrez Gene ID: 9745
Uniprot ID: O15090
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF536
Alternative Gene Name: KIAA0390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043456: 77%, ENSRNOG00000014163: 80%
Entrez Gene ID: 9745
Uniprot ID: O15090
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPL |
Documents & Links for Anti ZNF536 pAb (ATL-HPA077341) | |
Datasheet | Anti ZNF536 pAb (ATL-HPA077341) Datasheet (External Link) |
Vendor Page | Anti ZNF536 pAb (ATL-HPA077341) at Atlas |
Documents & Links for Anti ZNF536 pAb (ATL-HPA077341) | |
Datasheet | Anti ZNF536 pAb (ATL-HPA077341) Datasheet (External Link) |
Vendor Page | Anti ZNF536 pAb (ATL-HPA077341) |