Anti ZNF536 pAb (ATL-HPA077341)

Catalog No:
ATL-HPA077341-25
$447.00
Protein Description: zinc finger protein 536
Gene Name: ZNF536
Alternative Gene Name: KIAA0390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043456: 77%, ENSRNOG00000014163: 80%
Entrez Gene ID: 9745
Uniprot ID: O15090
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence AFCNFPSDFYKQFGVYPGMVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMMTKPL
Gene ID - Mouse ENSMUSG00000043456
Gene ID - Rat ENSMUSG00000043456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ZNF536 pAb (ATL-HPA077341)
Datasheet Anti ZNF536 pAb (ATL-HPA077341) Datasheet (External Link)
Vendor Page Anti ZNF536 pAb (ATL-HPA077341) at Atlas

Documents & Links for Anti ZNF536 pAb (ATL-HPA077341)
Datasheet Anti ZNF536 pAb (ATL-HPA077341) Datasheet (External Link)
Vendor Page Anti ZNF536 pAb (ATL-HPA077341)