Description
Product Description
Protein Description: zinc finger protein 500
Gene Name: ZNF500
Alternative Gene Name: KIAA0557, ZKSCAN18, ZSCAN50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038456: 32%, ENSRNOG00000014230: 30%
Entrez Gene ID: 26048
Uniprot ID: O60304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF500
Alternative Gene Name: KIAA0557, ZKSCAN18, ZSCAN50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038456: 32%, ENSRNOG00000014230: 30%
Entrez Gene ID: 26048
Uniprot ID: O60304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEPRCMDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAPVRGLVRPDQPRG |
Gene Sequence | EEPRCMDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAPVRGLVRPDQPRG |
Gene ID - Mouse | ENSMUSG00000038456 |
Gene ID - Rat | ENSRNOG00000014230 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF500 pAb (ATL-HPA057963) | |
Datasheet | Anti ZNF500 pAb (ATL-HPA057963) Datasheet (External Link) |
Vendor Page | Anti ZNF500 pAb (ATL-HPA057963) at Atlas Antibodies |
Documents & Links for Anti ZNF500 pAb (ATL-HPA057963) | |
Datasheet | Anti ZNF500 pAb (ATL-HPA057963) Datasheet (External Link) |
Vendor Page | Anti ZNF500 pAb (ATL-HPA057963) |