Protein Description: zinc finger protein 473
Gene Name: ZNF473
Alternative Gene Name: DKFZP434N043, HZFP100, KIAA1141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048012: 51%, ENSRNOG00000026572: 59%
Entrez Gene ID: 25888
Uniprot ID: Q8WTR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF473
Alternative Gene Name: DKFZP434N043, HZFP100, KIAA1141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048012: 51%, ENSRNOG00000026572: 59%
Entrez Gene ID: 25888
Uniprot ID: Q8WTR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRPNLTSHPDGSEDLEPLAGG |
Documents & Links for Anti ZNF473 pAb (ATL-HPA073309) | |
Datasheet | Anti ZNF473 pAb (ATL-HPA073309) Datasheet (External Link) |
Vendor Page | Anti ZNF473 pAb (ATL-HPA073309) at Atlas |
Documents & Links for Anti ZNF473 pAb (ATL-HPA073309) | |
Datasheet | Anti ZNF473 pAb (ATL-HPA073309) Datasheet (External Link) |
Vendor Page | Anti ZNF473 pAb (ATL-HPA073309) |