Protein Description: zinc finger protein 471
Gene Name: ZNF471
Alternative Gene Name: KIAA1396, Z1971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055150: 38%, ENSRNOG00000015322: 44%
Entrez Gene ID: 57573
Uniprot ID: Q9BX82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF471
Alternative Gene Name: KIAA1396, Z1971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055150: 38%, ENSRNOG00000015322: 44%
Entrez Gene ID: 57573
Uniprot ID: Q9BX82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ESIYVTQELPLKQFMYDDACMEGITSYGLECS |
| Documents & Links for Anti ZNF471 pAb (ATL-HPA066695) | |
| Datasheet | Anti ZNF471 pAb (ATL-HPA066695) Datasheet (External Link) |
| Vendor Page | Anti ZNF471 pAb (ATL-HPA066695) at Atlas |
| Documents & Links for Anti ZNF471 pAb (ATL-HPA066695) | |
| Datasheet | Anti ZNF471 pAb (ATL-HPA066695) Datasheet (External Link) |
| Vendor Page | Anti ZNF471 pAb (ATL-HPA066695) |
| Citations for Anti ZNF471 pAb (ATL-HPA066695) – 1 Found |
| Sun, Ran; Xiang, Tingxiu; Tang, Jun; Peng, Weiyan; Luo, Jie; Li, Lili; Qiu, Zhu; Tan, Yiqing; Ye, Lin; Zhang, Min; Ren, Guosheng; Tao, Qian. 19q13 KRAB zinc-finger protein ZNF471 activates MAPK10/JNK3 signaling but is frequently silenced by promoter CpG methylation in esophageal cancer. Theranostics. 10(5):2243-2259. PubMed |