Protein Description: zinc finger protein 446
Gene Name: ZNF446
Alternative Gene Name: FLJ20626, ZKSCAN20, ZSCAN52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033961: 36%,
Entrez Gene ID: 55663
Uniprot ID: Q9NWS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF446
Alternative Gene Name: FLJ20626, ZKSCAN20, ZSCAN52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033961: 36%,
Entrez Gene ID: 55663
Uniprot ID: Q9NWS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEE |
| Documents & Links for Anti ZNF446 pAb (ATL-HPA078262) | |
| Datasheet | Anti ZNF446 pAb (ATL-HPA078262) Datasheet (External Link) |
| Vendor Page | Anti ZNF446 pAb (ATL-HPA078262) at Atlas |
| Documents & Links for Anti ZNF446 pAb (ATL-HPA078262) | |
| Datasheet | Anti ZNF446 pAb (ATL-HPA078262) Datasheet (External Link) |
| Vendor Page | Anti ZNF446 pAb (ATL-HPA078262) |