Protein Description: zinc finger protein 444
Gene Name: ZNF444
Alternative Gene Name: EZF2, FLJ11137, ZSCAN17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044876: 81%, ENSRNOG00000015517: 81%
Entrez Gene ID: 55311
Uniprot ID: Q8N0Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF444
Alternative Gene Name: EZF2, FLJ11137, ZSCAN17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044876: 81%, ENSRNOG00000015517: 81%
Entrez Gene ID: 55311
Uniprot ID: Q8N0Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGE |
| Documents & Links for Anti ZNF444 pAb (ATL-HPA065203) | |
| Datasheet | Anti ZNF444 pAb (ATL-HPA065203) Datasheet (External Link) |
| Vendor Page | Anti ZNF444 pAb (ATL-HPA065203) at Atlas |
| Documents & Links for Anti ZNF444 pAb (ATL-HPA065203) | |
| Datasheet | Anti ZNF444 pAb (ATL-HPA065203) Datasheet (External Link) |
| Vendor Page | Anti ZNF444 pAb (ATL-HPA065203) |