Description
Product Description
Protein Description: zinc finger protein 423
Gene Name: ZNF423
Alternative Gene Name: Ebfaz, JBTS19, KIAA0760, NPHP14, OAZ, Roaz, Zfp104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045333: 97%, ENSRNOG00000014658: 97%
Entrez Gene ID: 23090
Uniprot ID: Q2M1K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF423
Alternative Gene Name: Ebfaz, JBTS19, KIAA0760, NPHP14, OAZ, Roaz, Zfp104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045333: 97%, ENSRNOG00000014658: 97%
Entrez Gene ID: 23090
Uniprot ID: Q2M1K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKV |
| Gene Sequence | QPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKV |
| Gene ID - Mouse | ENSMUSG00000045333 |
| Gene ID - Rat | ENSRNOG00000014658 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ZNF423 pAb (ATL-HPA065820) | |
| Datasheet | Anti ZNF423 pAb (ATL-HPA065820) Datasheet (External Link) |
| Vendor Page | Anti ZNF423 pAb (ATL-HPA065820) at Atlas Antibodies |
| Documents & Links for Anti ZNF423 pAb (ATL-HPA065820) | |
| Datasheet | Anti ZNF423 pAb (ATL-HPA065820) Datasheet (External Link) |
| Vendor Page | Anti ZNF423 pAb (ATL-HPA065820) |