Protein Description: zinc finger protein 398
Gene Name: ZNF398
Alternative Gene Name: KIAA1339, P51, P71, ZER6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062519: 82%, ENSRNOG00000006703: 84%
Entrez Gene ID: 57541
Uniprot ID: Q8TD17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF398
Alternative Gene Name: KIAA1339, P51, P71, ZER6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062519: 82%, ENSRNOG00000006703: 84%
Entrez Gene ID: 57541
Uniprot ID: Q8TD17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYG |
Documents & Links for Anti ZNF398 pAb (ATL-HPA071533) | |
Datasheet | Anti ZNF398 pAb (ATL-HPA071533) Datasheet (External Link) |
Vendor Page | Anti ZNF398 pAb (ATL-HPA071533) at Atlas |
Documents & Links for Anti ZNF398 pAb (ATL-HPA071533) | |
Datasheet | Anti ZNF398 pAb (ATL-HPA071533) Datasheet (External Link) |
Vendor Page | Anti ZNF398 pAb (ATL-HPA071533) |