Anti ZNF383 pAb (ATL-HPA063945)

Catalog No:
ATL-HPA063945-25
$447.00

Description

Product Description

Protein Description: zinc finger protein 383
Gene Name: ZNF383
Alternative Gene Name: FLJ35863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 51%, ENSRNOG00000020774: 60%
Entrez Gene ID: 163087
Uniprot ID: Q8NA42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF
Gene Sequence SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF
Gene ID - Mouse ENSMUSG00000099689
Gene ID - Rat ENSRNOG00000020774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF383 pAb (ATL-HPA063945)
Datasheet Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link)
Vendor Page Anti ZNF383 pAb (ATL-HPA063945) at Atlas Antibodies

Documents & Links for Anti ZNF383 pAb (ATL-HPA063945)
Datasheet Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link)
Vendor Page Anti ZNF383 pAb (ATL-HPA063945)

Product Description

Protein Description: zinc finger protein 383
Gene Name: ZNF383
Alternative Gene Name: FLJ35863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 51%, ENSRNOG00000020774: 60%
Entrez Gene ID: 163087
Uniprot ID: Q8NA42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF
Gene Sequence SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF
Gene ID - Mouse ENSMUSG00000099689
Gene ID - Rat ENSRNOG00000020774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNF383 pAb (ATL-HPA063945)
Datasheet Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link)
Vendor Page Anti ZNF383 pAb (ATL-HPA063945) at Atlas Antibodies

Documents & Links for Anti ZNF383 pAb (ATL-HPA063945)
Datasheet Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link)
Vendor Page Anti ZNF383 pAb (ATL-HPA063945)