Protein Description: zinc finger protein 383
Gene Name: ZNF383
Alternative Gene Name: FLJ35863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 51%, ENSRNOG00000020774: 60%
Entrez Gene ID: 163087
Uniprot ID: Q8NA42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF383
Alternative Gene Name: FLJ35863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 51%, ENSRNOG00000020774: 60%
Entrez Gene ID: 163087
Uniprot ID: Q8NA42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF |
Documents & Links for Anti ZNF383 pAb (ATL-HPA063945) | |
Datasheet | Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link) |
Vendor Page | Anti ZNF383 pAb (ATL-HPA063945) at Atlas |
Documents & Links for Anti ZNF383 pAb (ATL-HPA063945) | |
Datasheet | Anti ZNF383 pAb (ATL-HPA063945) Datasheet (External Link) |
Vendor Page | Anti ZNF383 pAb (ATL-HPA063945) |