Protein Description: zinc finger protein 366
Gene Name: ZNF366
Alternative Gene Name: FLJ39796
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050919: 52%, ENSRNOG00000017249: 50%
Entrez Gene ID: 167465
Uniprot ID: Q8N895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF366
Alternative Gene Name: FLJ39796
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050919: 52%, ENSRNOG00000017249: 50%
Entrez Gene ID: 167465
Uniprot ID: Q8N895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | STKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERK |
Documents & Links for Anti ZNF366 pAb (ATL-HPA023128) | |
Datasheet | Anti ZNF366 pAb (ATL-HPA023128) Datasheet (External Link) |
Vendor Page | Anti ZNF366 pAb (ATL-HPA023128) at Atlas |
Documents & Links for Anti ZNF366 pAb (ATL-HPA023128) | |
Datasheet | Anti ZNF366 pAb (ATL-HPA023128) Datasheet (External Link) |
Vendor Page | Anti ZNF366 pAb (ATL-HPA023128) |