Description
Product Description
Protein Description: zinc finger protein 354C
Gene Name: ZNF354C
Alternative Gene Name: KID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044807: 51%, ENSRNOG00000029205: 54%
Entrez Gene ID: 30832
Uniprot ID: Q86Y25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF354C
Alternative Gene Name: KID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044807: 51%, ENSRNOG00000029205: 54%
Entrez Gene ID: 30832
Uniprot ID: Q86Y25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IEEEQEKKPLRQMIDSHEKTISEDGNHTSLELGKSLFTNTALVTQQSVPIERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICNECGK |
Gene Sequence | IEEEQEKKPLRQMIDSHEKTISEDGNHTSLELGKSLFTNTALVTQQSVPIERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICNECGK |
Gene ID - Mouse | ENSMUSG00000044807 |
Gene ID - Rat | ENSRNOG00000029205 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF354C pAb (ATL-HPA068570) | |
Datasheet | Anti ZNF354C pAb (ATL-HPA068570) Datasheet (External Link) |
Vendor Page | Anti ZNF354C pAb (ATL-HPA068570) at Atlas Antibodies |
Documents & Links for Anti ZNF354C pAb (ATL-HPA068570) | |
Datasheet | Anti ZNF354C pAb (ATL-HPA068570) Datasheet (External Link) |
Vendor Page | Anti ZNF354C pAb (ATL-HPA068570) |