Anti ZNF354C pAb (ATL-HPA068570)

Atlas Antibodies

Catalog No: ATL-HPA068570-25

• 

Product Description

Protein Description: zinc finger protein 354C
Gene Name: ZNF354C
Alternative Gene Name: KID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044807: 51%, ENSRNOG00000029205: 54%
Entrez Gene ID: 30832
Uniprot ID: Q86Y25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEEEQEKKPLRQMIDSHEKTISEDGNHTSLELGKSLFTNTALVTQQSVPIERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICNECGK
• Gene Sequence: IEEEQEKKPLRQMIDSHEKTISEDGNHTSLELGKSLFTNTALVTQQSVPIERIPNMYYTFGKDFKQNFDLMKCFQIYPGGKPHICNECGK
• Gene ID - Mouse: ENSMUSG00000044807
• Gene ID - Rat: ENSRNOG00000029205
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.