Anti ZNF341 pAb (ATL-HPA067108)

Atlas Antibodies

Catalog No: ATL-HPA067108-25

• 
• 

Product Description

Protein Description: zinc finger protein 341
Gene Name: ZNF341
Alternative Gene Name: dJ553F4.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059842: 84%, ENSRNOG00000032813: 30%
Entrez Gene ID: 84905
Uniprot ID: Q9BYN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEESTGLGQPLPGAPQPQALSTAGEEEGDKPESKQVVLIDSSY
• Gene Sequence: KVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEESTGLGQPLPGAPQPQALSTAGEEEGDKPESKQVVLIDSSY
• Gene ID - Mouse: ENSMUSG00000059842
• Gene ID - Rat: ENSRNOG00000032813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.