Protein Description: zinc finger protein 341
Gene Name: ZNF341
Alternative Gene Name: dJ553F4.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059842: 84%, ENSRNOG00000032813: 30%
Entrez Gene ID: 84905
Uniprot ID: Q9BYN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF341
Alternative Gene Name: dJ553F4.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059842: 84%, ENSRNOG00000032813: 30%
Entrez Gene ID: 84905
Uniprot ID: Q9BYN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEESTGLGQPLPGAPQPQALSTAGEEEGDKPESKQVVLIDSSY |
| Documents & Links for Anti ZNF341 pAb (ATL-HPA067108) | |
| Datasheet | Anti ZNF341 pAb (ATL-HPA067108) Datasheet (External Link) |
| Vendor Page | Anti ZNF341 pAb (ATL-HPA067108) at Atlas |
| Documents & Links for Anti ZNF341 pAb (ATL-HPA067108) | |
| Datasheet | Anti ZNF341 pAb (ATL-HPA067108) Datasheet (External Link) |
| Vendor Page | Anti ZNF341 pAb (ATL-HPA067108) |