Anti ZNF34 pAb (ATL-HPA066805)

Atlas Antibodies

Catalog No: ATL-HPA066805-25

• 

Product Description

Protein Description: zinc finger protein 34
Gene Name: ZNF34
Alternative Gene Name: KOX32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047342: 46%, ENSRNOG00000003218: 46%
Entrez Gene ID: 80778
Uniprot ID: Q8IZ26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSRPVPDQRPHKCDICEQSFEQRSYLNNHTRVHRS
• Gene Sequence: LSRPVPDQRPHKCDICEQSFEQRSYLNNHTRVHRS
• Gene ID - Mouse: ENSMUSG00000047342
• Gene ID - Rat: ENSRNOG00000003218
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.