Anti ZNF337 pAb (ATL-HPA064219)

Atlas Antibodies

Catalog No: ATL-HPA064219-25

• 

Product Description

Protein Description: zinc finger protein 337
Gene Name: ZNF337
Alternative Gene Name: dJ694B14.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063047: 32%, ENSRNOG00000021493: 37%
Entrez Gene ID: 26152
Uniprot ID: Q9Y3M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESSQGQRENPTEIDKVLKGIENSRWGAFKCAERGQDFSRKMMVIIHKKAHSRQKLFTCRECHQGFRDESALLLHQN
• Gene Sequence: ESSQGQRENPTEIDKVLKGIENSRWGAFKCAERGQDFSRKMMVIIHKKAHSRQKLFTCRECHQGFRDESALLLHQN
• Gene ID - Mouse: ENSMUSG00000063047
• Gene ID - Rat: ENSRNOG00000021493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.