Protein Description: zinc finger protein 335
Gene Name: ZNF335
Alternative Gene Name: bA465L10.2, NIF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039834: 85%, ENSRNOG00000017290: 82%
Entrez Gene ID: 63925
Uniprot ID: Q9H4Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF335
Alternative Gene Name: bA465L10.2, NIF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039834: 85%, ENSRNOG00000017290: 82%
Entrez Gene ID: 63925
Uniprot ID: Q9H4Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RNGHLKFHIQRLHSPDGRKSGTPTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQ |
Documents & Links for Anti ZNF335 pAb (ATL-HPA063999) | |
Datasheet | Anti ZNF335 pAb (ATL-HPA063999) Datasheet (External Link) |
Vendor Page | Anti ZNF335 pAb (ATL-HPA063999) at Atlas |
Documents & Links for Anti ZNF335 pAb (ATL-HPA063999) | |
Datasheet | Anti ZNF335 pAb (ATL-HPA063999) Datasheet (External Link) |
Vendor Page | Anti ZNF335 pAb (ATL-HPA063999) |