Protein Description: zinc finger protein 329
Gene Name: ZNF329
Alternative Gene Name: FLJ12586
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057894: 60%, ENSRNOG00000019376: 61%
Entrez Gene ID: 79673
Uniprot ID: Q86UD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF329
Alternative Gene Name: FLJ12586
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057894: 60%, ENSRNOG00000019376: 61%
Entrez Gene ID: 79673
Uniprot ID: Q86UD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | REKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKNFENIFTLSSSLNENQRNLPGEKQY |
| Gene ID - Mouse | ENSMUSG00000057894 |
| Gene ID - Rat | ENSMUSG00000057894 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF329 pAb (ATL-HPA077958) | |
| Datasheet | Anti ZNF329 pAb (ATL-HPA077958) Datasheet (External Link) |
| Vendor Page | Anti ZNF329 pAb (ATL-HPA077958) at Atlas |
| Documents & Links for Anti ZNF329 pAb (ATL-HPA077958) | |
| Datasheet | Anti ZNF329 pAb (ATL-HPA077958) Datasheet (External Link) |
| Vendor Page | Anti ZNF329 pAb (ATL-HPA077958) |