Anti ZNF329 pAb (ATL-HPA077958)

Catalog No:
ATL-HPA077958-25
$447.00
Protein Description: zinc finger protein 329
Gene Name: ZNF329
Alternative Gene Name: FLJ12586
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057894: 60%, ENSRNOG00000019376: 61%
Entrez Gene ID: 79673
Uniprot ID: Q86UD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence REKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKNFENIFTLSSSLNENQRNLPGEKQY
Gene ID - Mouse ENSMUSG00000057894
Gene ID - Rat ENSMUSG00000057894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ZNF329 pAb (ATL-HPA077958)
Datasheet Anti ZNF329 pAb (ATL-HPA077958) Datasheet (External Link)
Vendor Page Anti ZNF329 pAb (ATL-HPA077958) at Atlas

Documents & Links for Anti ZNF329 pAb (ATL-HPA077958)
Datasheet Anti ZNF329 pAb (ATL-HPA077958) Datasheet (External Link)
Vendor Page Anti ZNF329 pAb (ATL-HPA077958)