Anti ZNF302 pAb (ATL-HPA059503)

Atlas Antibodies

Catalog No: ATL-HPA059503-25

• 

Product Description

Protein Description: zinc finger protein 302
Gene Name: ZNF302
Alternative Gene Name: ZNF135L, ZNF140L, ZNF327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027115: 30%, ENSRNOG00000053260: 28%
Entrez Gene ID: 55900
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA
• Gene Sequence: KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA
• Gene ID - Mouse: ENSMUSG00000027115
• Gene ID - Rat: ENSRNOG00000053260
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.