Description
Product Description
Protein Description: zinc finger protein 302
Gene Name: ZNF302
Alternative Gene Name: ZNF135L, ZNF140L, ZNF327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027115: 30%, ENSRNOG00000053260: 28%
Entrez Gene ID: 55900
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF302
Alternative Gene Name: ZNF135L, ZNF140L, ZNF327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027115: 30%, ENSRNOG00000053260: 28%
Entrez Gene ID: 55900
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA |
Gene Sequence | KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA |
Gene ID - Mouse | ENSMUSG00000027115 |
Gene ID - Rat | ENSRNOG00000053260 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF302 pAb (ATL-HPA059503) | |
Datasheet | Anti ZNF302 pAb (ATL-HPA059503) Datasheet (External Link) |
Vendor Page | Anti ZNF302 pAb (ATL-HPA059503) at Atlas Antibodies |
Documents & Links for Anti ZNF302 pAb (ATL-HPA059503) | |
Datasheet | Anti ZNF302 pAb (ATL-HPA059503) Datasheet (External Link) |
Vendor Page | Anti ZNF302 pAb (ATL-HPA059503) |