Protein Description: zinc finger protein 283
Gene Name: ZNF283
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053985: 37%, ENSRNOG00000030932: 33%
Entrez Gene ID: 284349
Uniprot ID: Q8N7M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF283
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053985: 37%, ENSRNOG00000030932: 33%
Entrez Gene ID: 284349
Uniprot ID: Q8N7M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SQWEMKDKSKTLGLEASIFRNNWKCKSIFEGLKGHQEGYFSQMIISYEKIPSYRKSKSLTPHQ |
| Documents & Links for Anti ZNF283 pAb (ATL-HPA072977) | |
| Datasheet | Anti ZNF283 pAb (ATL-HPA072977) Datasheet (External Link) |
| Vendor Page | Anti ZNF283 pAb (ATL-HPA072977) at Atlas |
| Documents & Links for Anti ZNF283 pAb (ATL-HPA072977) | |
| Datasheet | Anti ZNF283 pAb (ATL-HPA072977) Datasheet (External Link) |
| Vendor Page | Anti ZNF283 pAb (ATL-HPA072977) |