Anti ZNF280B pAb (ATL-HPA059519)

Atlas Antibodies

Catalog No: ATL-HPA059519-25

• 
• 

Product Description

Protein Description: zinc finger protein 280B
Gene Name: ZNF280B
Alternative Gene Name: 5'OY11.1, SUHW2, ZNF279, ZNF632
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049764: 51%, ENSRNOG00000052545: 47%
Entrez Gene ID: 140883
Uniprot ID: Q86YH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSPIIIEPLSKPDYRNSSPQVVPNNSSELPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGII
• Gene Sequence: DSPIIIEPLSKPDYRNSSPQVVPNNSSELPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGII
• Gene ID - Mouse: ENSMUSG00000049764
• Gene ID - Rat: ENSRNOG00000052545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.