![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99244/178729/atl-hpa063908_anti-znf207-pab-atl-hpa063908-wenhanced-validation_60391__94158.1681134272.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: zinc finger protein 207
Gene Name: ZNF207
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017421: 100%, ENSRNOG00000000236: 100%
Entrez Gene ID: 7756
Uniprot ID: O43670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF207
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017421: 100%, ENSRNOG00000000236: 100%
Entrez Gene ID: 7756
Uniprot ID: O43670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQ |
| Documents & Links for Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) | |
| Datasheet | Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) at Atlas |
| Documents & Links for Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) | |
| Datasheet | Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) |