Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation)

Catalog No:
ATL-HPA063908-25
$303.00

Description

Product Description

Protein Description: zinc finger protein 207
Gene Name: ZNF207
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017421: 100%, ENSRNOG00000000236: 100%
Entrez Gene ID: 7756
Uniprot ID: O43670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQ
Gene Sequence WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQ
Gene ID - Mouse ENSMUSG00000017421
Gene ID - Rat ENSRNOG00000000236
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation)
Datasheet Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation)

Product Description

Protein Description: zinc finger protein 207
Gene Name: ZNF207
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017421: 100%, ENSRNOG00000000236: 100%
Entrez Gene ID: 7756
Uniprot ID: O43670
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQ
Gene Sequence WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQ
Gene ID - Mouse ENSMUSG00000017421
Gene ID - Rat ENSRNOG00000000236
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation)
Datasheet Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF207 pAb (ATL-HPA063908 w/enhanced validation)