Protein Description: zinc finger protein 19
Gene Name: ZNF19
Alternative Gene Name: KOX12, MGC51021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000100235: 36%, ENSRNOG00000016186: 34%
Entrez Gene ID: 7567
Uniprot ID: P17023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF19
Alternative Gene Name: KOX12, MGC51021
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000100235: 36%, ENSRNOG00000016186: 34%
Entrez Gene ID: 7567
Uniprot ID: P17023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW |
| Documents & Links for Anti ZNF19 pAb (ATL-HPA063685) | |
| Datasheet | Anti ZNF19 pAb (ATL-HPA063685) Datasheet (External Link) |
| Vendor Page | Anti ZNF19 pAb (ATL-HPA063685) at Atlas |
| Documents & Links for Anti ZNF19 pAb (ATL-HPA063685) | |
| Datasheet | Anti ZNF19 pAb (ATL-HPA063685) Datasheet (External Link) |
| Vendor Page | Anti ZNF19 pAb (ATL-HPA063685) |