Anti ZNF182 pAb (ATL-HPA059574)

Atlas Antibodies

Catalog No: ATL-HPA059574-25

• 
• 

Product Description

Protein Description: zinc finger protein 182
Gene Name: ZNF182
Alternative Gene Name: HHZ150, KOX14, Zfp182, ZNF21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054737: 62%, ENSRNOG00000047132: 51%
Entrez Gene ID: 7569
Uniprot ID: P17025
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDE
• Gene Sequence: YSNLVFVGQQVTKPNLILKLEVEECPAEGKIPFWNFPEVCQVDE
• Gene ID - Mouse: ENSMUSG00000054737
• Gene ID - Rat: ENSRNOG00000047132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.