Protein Description: zinc finger protein 181
Gene Name: ZNF181
Alternative Gene Name: HHZ181, MGC44316
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078872: 42%, ENSRNOG00000032625: 38%
Entrez Gene ID: 339318
Uniprot ID: Q2M3W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF181
Alternative Gene Name: HHZ181, MGC44316
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078872: 42%, ENSRNOG00000032625: 38%
Entrez Gene ID: 339318
Uniprot ID: Q2M3W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VHNGEKPNSVVSVEKPLDHMNPYTCEKSYRRET |
| Documents & Links for Anti ZNF181 pAb (ATL-HPA062305) | |
| Datasheet | Anti ZNF181 pAb (ATL-HPA062305) Datasheet (External Link) |
| Vendor Page | Anti ZNF181 pAb (ATL-HPA062305) at Atlas |
| Documents & Links for Anti ZNF181 pAb (ATL-HPA062305) | |
| Datasheet | Anti ZNF181 pAb (ATL-HPA062305) Datasheet (External Link) |
| Vendor Page | Anti ZNF181 pAb (ATL-HPA062305) |