Anti ZNF181 pAb (ATL-HPA062305)

Atlas Antibodies

Catalog No: ATL-HPA062305-25

• 

Product Description

Protein Description: zinc finger protein 181
Gene Name: ZNF181
Alternative Gene Name: HHZ181, MGC44316
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078872: 42%, ENSRNOG00000032625: 38%
Entrez Gene ID: 339318
Uniprot ID: Q2M3W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHNGEKPNSVVSVEKPLDHMNPYTCEKSYRRET
• Gene Sequence: VHNGEKPNSVVSVEKPLDHMNPYTCEKSYRRET
• Gene ID - Mouse: ENSMUSG00000078872
• Gene ID - Rat: ENSRNOG00000032625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.